PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G105600.1
Common NameB456_005G105600, LOC105796138
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 228aa    MW: 25364.9 Da    PI: 10.6825
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G105600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-3284137255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH++Fv+av+ LGG+++AtPk++lelm+vk Ltl+hvkSHLQ+YR+
  Gorai.005G105600.1  84 PRMRWTTTLHAHFVHAVQLLGGHDRATPKSVLELMNVKNLTLAHVKSHLQMYRT 137
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.94E-1681138IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-2882138IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-2384137IPR006447Myb domain, plants
PfamPF002492.8E-885136IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MISPTSVSVC RVKGMTYYRS STTDSSCSGT NLSQGQPKLS LGFETAVLSP PQPKLNHHQP  60
QIYGRDFERN ARMINGVKRR MRAPRMRWTT TLHAHFVHAV QLLGGHDRAT PKSVLELMNV  120
KNLTLAHVKS HLQMYRTVKS TNKGSANLQT SPQRTQSDPW LSSMETNNLI ISGHGNSFTF  180
KSNDAKVEVD KAELQVSDRL KDRLDSSSLS PSNILLNLEF TLGMPLF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2834724e-69KP283472.1 Prunus armeniaca aberrant testa shape (ATS) gene, complete cds.
GenBankKP2834734e-69KP283473.1 Prunus incisa isolate 462-2010A aberrant testa shape (ATS) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012481201.11e-170PREDICTED: probable transcription factor KAN4 isoform X2
SwissprotQ9FJV51e-50KAN4_ARATH; Probable transcription factor KAN4
TrEMBLA0A0D2SEB11e-170A0A0D2SEB1_G
STRINGVIT_18s0001g11390.t014e-74(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65722844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.23e-51G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]